LL-37 Vial 5 mg Lot LL37-5-001: Certificate of Analysis (COA)
Peptira · tested Dec 26, 2025 by Freedom Diagnostics · Older lot
This page summarizes the third-party lab report for lot LL37-5-001 of LL-37 Vial 5 mg sold by Peptira. The lot number on this page should match the lot printed on the vial label. Don't rely on this summary alone: use the button to open the lab's own record and compare the lot, date and results.
LL-37 Vial 5 mg lot LL37-5-001 test results, explained
Every result printed on this certificate, as reported by Freedom Diagnostics, with a plain-English note on what the test measures. "Pass" and "specification" wording comes from the certificate; where the lab prints no pass/fail, we say so.
| Test | Result on the certificate | What it measures | This lot |
|---|---|---|---|
| HPLC purity | 99.787% | HPLC separates the sample into its components; purity is the share of the detected signal that sits in the main peak. On its own it doesn't show which molecule that peak is. That's what the identity test is for. | No pass/fail printed; reported value at or above 98% |
| Identity (LC-MS) | Mass identified as LL-37 · compound named: LL-37 · mass identification table: LL-37: 99.787% | Mass spectrometry measures the molecular mass of what's in the vial and compares it with the declared compound. "Confirmed" means the lab found the expected compound. Expected average molecular weight of LL-37 (PubChem): 4493 g/mol. The observed mass appears in the certificate's chart and isn't transcribed here. | Reported as matching the declared compound |
| Appearance | White Lyophilized Powder | What the lab recorded before testing: the colour and physical form of the material. | Recorded |
Lot and report details
| Lot / batch number | LL37-5-001 |
|---|---|
| Product (as labeled by vendor) | LL-37 Vial 5 mg |
| Labeled vial size | 5 mg |
| Testing laboratory | Freedom Diagnostics |
| Sample received by lab | Dec 24, 2025 |
| Report date | Dec 26, 2025 |
| Method (as stated) | HPLC with UV detection coupled with mass spectrometry (LC-MS) |
| Search Code | Pept2512240063 |
| Lab-record check | On Oct 7, 2026 the vendor's PDF was byte-for-byte identical to the copy hosted on the lab's site. |
| Vendor | Peptira |
| Verify | Open Freedom Diagnostics's record ↗ |
Data notes: Lab received 12/24/2025, reported 12/26/2025 (MM/DD/YYYY).
The certificate itself
About Freedom Diagnostics
A peptide testing lab in Franklin, Tennessee (per the lab's website) that publishes its certificates in a searchable online database.
Accreditation: No accreditation is printed on these certificates, and we found no published ISO/IEC 17025 accreditation for the lab (checked Oct 7, 2026).
Tests: On the certificates here: HPLC purity with LC-MS identity, net content and, where ordered, endotoxin (LAL), a microbial PCR screen and other screens.
How to verify: Search the Search Code on freedomdiagnosticstesting.com. The lab hosts its own PDF copy of each certificate, which should match the vendor's copy.
Open Freedom Diagnostics's record ↗Lab info from: freedomdiagnosticstesting.com · checked Oct 7, 2026.
Compound reference: LL-37
- Also called
- cathelicidin LL-37; human cathelicidin antimicrobial peptide
- Sequence
- [LL-37, 37 aa] (37 residues)
- Formula
- C205H340N60O53
- Mol. weight
- 4493 g/mol
- CAS
- 154947-66-7
- Source
- PubChem CID 16198951 ↗
A 37-residue peptide, the active fragment of the human cathelicidin protein. Reference data only; it describes the molecule, not any use of it. For laboratory research use only.
LL-37 Vial 5 mg lot history at Peptira
All 2 certificates we have for this product from Peptira, newest first. The chart plots HPLC purity by report date (lots without a purity figure are left out). This lot is highlighted.
| Lot | Report date | Lab | HPLC purity |
|---|---|---|---|
| LL37-5-002 | Jan 31, 2026 | Freedom Diagnostics | 99.93% |
| LL37-5-001 | Dec 26, 2025 | Freedom Diagnostics | 99.79% |
Also available from Paramount Peptides
LL-37 is also carried by Paramount Peptides, our other tested supplier. These are the most recent LL-37 certificates we have from them; each links to its own lot page.
| Product | Lot | Report date | Lab | HPLC purity |
|---|---|---|---|---|
| LL-37 (5mg) | L375N070725 | Jul 16, 2025 | Janoshik | 99.27% |
| LL-37 (5mg) | LL375A061125 | Jun 19, 2025 | Janoshik | 99.74% |
Where to get lab-tested LL-37: products, sizes and latest COAs →
What to check on your vial
- The lot number on the vial label reads LL37-5-001, character for character.
- The product name and vial size on the label match LL-37 Vial 5 mg (5 mg).
- The lab's own record (freedomdiagnosticstesting.com, code Pept2512240063) shows the same lot, report date (Dec 26, 2025) and results as this page.
- The report date is a date you'd expect for your purchase: a much older certificate may belong to an earlier lot.
- The identity line names the compound you expect. If it's "Not reported", the certificate doesn't confirm which molecule is in the vial.
- The certificate is a clean document: no mismatched fonts, edited numbers or a missing verification code.
How to check this COA in under a minute
- Find the lot number on your vial label and confirm it reads LL37-5-001.
- Open Freedom Diagnostics's record with the button above, or go to freedomdiagnosticstesting.com and enter Pept2512240063.
- Compare the lot number, test date, purity and identity result with the table above. They should be identical.
- New to COAs? Read How to read a peptide COA for what HPLC purity and mass spec identity mean.
Questions about lot LL37-5-001
What HPLC purity did LL-37 Vial 5 mg lot LL37-5-001 test at?
Freedom Diagnostics reported 99.79% HPLC purity for lot LL37-5-001 in a report dated Dec 26, 2025.
How do I verify the COA for lot LL37-5-001?
Go to freedomdiagnosticstesting.com and enter the search code Pept2512240063. The lab's own record should show lot LL37-5-001 with the same dates and results as this page.
Is lot LL37-5-001 the newest LL-37 Vial 5 mg lot from Peptira?
No. The most recent LL-37 Vial 5 mg certificate we have from Peptira is lot LL37-5-002. Your vial label tells you which lot you have.
Does this certificate apply to my vial?
Only if the lot number printed on your vial reads LL37-5-001 exactly. A certificate of analysis covers one lot; it says nothing about other lots of the same product.
Other lots and COAs
LL-37 Vial 5 mg at Peptira
Lab-tested lot LL37-5-001 · 99.79% HPLC purity · Freedom Diagnostics
Affiliate disclosure: We earn a commission if you buy through the vendor links on this page, at no extra cost to you. Peptides & Coffee is an independent COA reference and is not owned by or affiliated with the vendors or labs listed. Lab results are published by the vendors and labs; we link to each lab's own verification record so you can check them yourself. Stock and lots change: the vendor may be shipping a newer lot than the one on this page, so check your vial label.